DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and mrc1b

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001297773.1 Gene:mrc1b / 559502 ZFINID:ZDB-GENE-070705-13 Length:1428 Species:Danio rerio


Alignment Length:326 Identity:69/326 - (21%)
Similarity:123/326 - (37%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGF 90
            |...|.|..|::.. :|.|:::...|..|..|::.|||:|.:|..:.:.|:    ..:..:|:|:
Zfish   344 EVTTGFCQSPWIPH-SGNCYFLHRTKQTWLEARDICLREGGDLLSILSTEE----QSFAITQLGY 403

  Fly    91 ---DDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRS-NLDDCLEIRIRPNVTVVLDVN 151
               |..|.|.||.:::..|::.....:.  .....:.|||..: :.:||  :.:|.......|..
Zfish   404 SKTDQLWIGFNDRKTQMLFEWSDQSSVP--FASWEVGEPTHSAQHAEDC--VLMRGEEGKWADDV 464

  Fly   152 CQEKKYFICEQNQMKCAVPAED-----SGDGQKHSHEHLHHFHHDAGQKDKQETGIKEQSVESDS 211
            |::|..|||::   |.:..|.:     :..|.|.......::.:.||.:.|.....|:...:::|
Zfish   465 CEKKYGFICKR---KTSTKASNNDTVVANPGCKKGWIRYGYYCYMAGSETKTSEEAKQTCEKAES 526

  Fly   212 RPADNSNSTE-----------------IGVSKEKEAEGAPTPGDGGGTTEPVFENGMENAAE-PI 258
            |..|.|:..|                 ||:|.:|:..              .||  ..|..: |.
Zfish   527 RLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVH--------------TFE--WTNTKQVPF 575

  Fly   259 AEQEQTVPPGGTGPPAAADATGAATPAPDAAA------------AEGATPAAAPPAEGAPAAEAA 311
            ......:|  |......|..||......|..:            |:.....||||.  .|:.:..
Zfish   576 THFNSGMP--GRKQGCVAMTTGIVAGLWDVLSCSNKEKYICKQRADALVTTAAPPT--TPSLDCP 636

  Fly   312 T 312
            |
Zfish   637 T 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/122 (25%)
mrc1bNP_001297773.1 RICIN 25..>117 CDD:238092
fn2 163..204 CDD:278469
CLECT 227..334 CDD:153057
CLECT 350..474 CDD:214480 32/132 (24%)
CLECT 493..615 CDD:214480 24/139 (17%)
CLECT 648..764 CDD:153057
CLECT 785..905 CDD:214480
CLECT 926..1062 CDD:214480
CLECT 1089..1196 CDD:153057
CLECT 1223..1347 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BNTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.