DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:ch211-225k7.6

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001093462.1 Gene:si:ch211-225k7.6 / 558654 ZFINID:ZDB-GENE-070705-121 Length:359 Species:Danio rerio


Alignment Length:146 Identity:30/146 - (20%)
Similarity:58/146 - (39%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKC----FYV------GI----KKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQV-GF 90
            :|||    |.:      |:    :.:||..||:.|.:..::|..|....:.:.:..::...: ..
Zfish   111 DGKCSDTWFVICYNMSRGLVFVNQTMNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFINDSIPSR 175

  Fly    91 DDFWFG------GNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLD 149
            .|.|.|      .:| ||...|.|            .|..||....|.::|..::...|.... |
Zfish   176 SDVWIGLFRDWQWSD-QSNYSFSY------------WNTNEPNNYGNNENCTVLKENTNGHWA-D 226

  Fly   150 VNCQEKKYFICEQNQM 165
            ::|..:..|:|.::::
Zfish   227 ISCDCQFPFVCHEDKL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/139 (21%)
si:ch211-225k7.6NP_001093462.1 CLECT 23..124 CDD:470576 4/12 (33%)
CLECT 127..238 CDD:470576 25/124 (20%)
CLECT 244..356 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.