DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-30A

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:52/121 - (42%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKY 108
            ||:..: |.|||||.|.|.:.|.::|.:...::|..:.....:.|    ||...|.:...|.|..
  Fly   113 FYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPAGV----FWIDMNAMFKNGLFAS 173

  Fly   109 ISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQ 164
            ..:|:...:..    .:..:|.|..||:.:..:.    :.:.||.....|||:..|
  Fly   174 SLTGRSPPFFK----WKKEERGNKFDCVNVYNKE----MYNENCFNTHLFICQAEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/117 (25%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 26/111 (23%)

Return to query results.
Submit another query.