DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:316 Identity:147/316 - (46%)
Similarity:185/316 - (58%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWF 95
            ||.:.|||.:||||:|..:||:|||||.||||||||.|||:|...||...:.:::.....:||||
  Fly    26 PCPRRYLRRINGKCYYFSVKKMNWFGALNNCLRKGLTLADLSNQRDFDGAIGFLSGLGNTEDFWF 90

  Fly    96 GGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFIC 160
            |||||..||||:|||:|:||||..:.:.|.|.:.|..|||||:|||..:.:|...||.|::||||
  Fly    91 GGNDLYHEGRFQYISNGRLVRYYSNYSNVLPLEHSECDDCLEVRIRSEINMVSADNCHERQYFIC 155

  Fly   161 EQNQMKCAVPAEDSGDGQK-HSHEHLHHFHHD-AGQKDKQETGIKEQSVESDSRPADNSNSTEIG 223
            .:...:    ..|||...| |||||||||||| .|..:.::.|  :...:.|.:....|.|.|..
  Fly   156 SERYCQ----GTDSGKKPKHHSHEHLHHFHHDIGGSAEGEDDG--DGDGDHDRQDPIASGSVEHP 214

  Fly   224 VSKEKEAEGA-PTPGDGGGTTEPVFENGMENAAEPIAEQEQTVPPGGTGPPAAADATGAATPAPD 287
            ....::|.|| ..|.|     :...:||:  :..|.||:..||  ||||.|.|     .||||..
  Fly   215 EPDSEDAVGALDVPDD-----DQPGQNGV--SVTPGAEETNTV--GGTGEPGA-----TATPAAG 265

  Fly   288 A----AAAEGATPA-AAPPAEGA--PAAEAATPAPA-APEGEA-------TPAPAA 328
            |    .|||||.|| |||.||||  |||:.|||||. ||..||       ||||.|
  Fly   266 AEAVSPAAEGAAPAGAAPAAEGAATPAADGATPAPTPAPGAEAPAAAAAETPAPPA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 64/118 (54%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 62/116 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2079
65.950

Return to query results.
Submit another query.