DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-33A

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster


Alignment Length:164 Identity:40/164 - (24%)
Similarity:66/164 - (40%) Gaps:26/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVH 82
            |...|:        |..|:.| :..||::|.:::.||..|..:|.:.|..|..:...||......
  Fly    18 CANAQT--------CPLPFSR-VGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTT 73

  Fly    83 YVTS------QVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIV--EPTQRSNLDDCLEIR 139
            ::.|      |......|.|.|.|.:...|....:|:.|.|:   |.|  ||...|..:||:...
  Fly    74 FLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYL---NWVPLEPNNASPEEDCVGFA 135

  Fly   140 IRPNVTVVLDVNCQEKKYFICEQNQMKCAVPAED 173
            .........|:.|:.:..::|::.      ||||
  Fly   136 NYNGAFGYHDIECKVQFPYVCQRE------PAED 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 31/126 (25%)
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.