DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4f

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:132 Identity:29/132 - (21%)
Similarity:60/132 - (45%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGR 105
            ||..:|....|..|..|:..|..:|.:||.|::.|:...:|...:|    .|.|.|..|..:||.
Mouse   420 NGNFYYFSRDKKPWREAEKFCTSQGAHLASVTSQEEQAFLVQTTSS----GDHWIGLTDQGTEGI 480

  Fly   106 FKYI-----SSGKLVRYMGDSNIVEPT----QRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICE 161
            ::::     ::.:...:.|.:   :|.    :....:||:.:|.:.|     |:.|.....::|:
Mouse   481 WRWVDGTPFNNAQSKGFWGKN---QPDNWRHRNGEREDCVHVRQQWN-----DMACGSSYPWVCK 537

  Fly   162 QN 163
            ::
Mouse   538 KS 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 27/127 (21%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511
MscS_porin 222..415 CDD:289559
CLECT_DC-SIGN_like 414..538 CDD:153060 29/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.