DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CLEC4A

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:153 Identity:29/153 - (18%)
Similarity:65/153 - (42%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VHS--GCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED 76
            ||:  .|.||....|:....|.....:..:..|:::..:..:|..::.:|.|...:|..::|.|:
Human    85 VHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEE 149

  Fly    77 FKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDD-CLEIRI 140
            ...:...:..:   ..::.|.:|.:.:..::::..   ..|...|....|.:.|:.:: |:.:..
Human   150 QDFIFQNLQEE---SAYFVGLSDPEGQRHWQWVDQ---TPYNESSTFWHPREPSDPNERCVVLNF 208

  Fly   141 R--PNVTVVLDVNCQEKKYFICE 161
            |  |......||||...:..:||
Human   209 RKSPKRWGWNDVNCLGPQRSVCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 22/122 (18%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 22/132 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.