DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd207

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:122 Identity:26/122 - (21%)
Similarity:45/122 - (36%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
            |..:|.......|:.|:..|:.:..:|..||: |.....::.|...:   ..|.|.....|||.:
  Rat   208 GNFYYFSRTPKTWYSAEQYCISRKAHLTSVSS-ESEHEFLYKVADGI---PHWIGLTKAGSEGDW 268

  Fly   107 KYISSGKLVRYMGDSNIV--EPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICE 161
            .::......:.......:  ||....|.:.|..||:.. :....|..|.....|||:
  Rat   269 YWVDQTSFNKEQSRRFWIPGEPNNVRNNEHCANIRVSA-LKCWNDSPCDNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/121 (21%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034
CLECT_DC-SIGN_like 202..325 CDD:153060 26/122 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.