DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209e

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001178934.1 Gene:Cd209e / 501797 RGDID:1563333 Length:207 Species:Rattus norvegicus


Alignment Length:133 Identity:32/133 - (24%)
Similarity:58/133 - (43%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGR 105
            ||.|::....:.:|..:...|......|..:.:.|: ::.:...:.:.|:.  |.|.:||..||.
  Rat    85 NGNCYFFSKSQRDWHNSITACQEMEAQLVTIKSPEE-QSFLQQTSKKNGYT--WMGLSDLNKEGE 146

  Fly   106 FKYISSGKLVRYMGDS--NIVEPTQRSNLD--DCLEIRIRP-NVTVVLDVNCQEKKYFICEQNQM 165
            :.::....|    .||  |.....|.:|:|  ||:|.|... |     |..|...|::||::...
  Rat   147 WYWLDGSPL----SDSLRNYWNEGQPNNIDGQDCVEFRNDGWN-----DAKCDNWKFWICKKTAT 202

  Fly   166 KCA 168
            .|:
  Rat   203 TCS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/123 (24%)
Cd209eNP_001178934.1 CLECT_DC-SIGN_like 77..199 CDD:153060 31/125 (25%)

Return to query results.
Submit another query.