DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:148 Identity:27/148 - (18%)
Similarity:61/148 - (41%) Gaps:14/148 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEKDKGPCGKPYLRELNGKCFYV-----GIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYV 84
            :||....|.|.: :.....|::|     ...|.:|..::.||...|.:|..:.:.|:    ..::
  Rat   100 EEKSWSCCPKNW-KPFGSHCYWVTKHTSTYSKASWNESEKNCFSMGAHLLVIHSKEE----QDFI 159

  Fly    85 TSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDD-CLEIRIRPNVTVVL 148
            |..:..|..:|.|.......:::::|.   ..|...:......:.|:.|: |:.|....:.....
  Rat   160 TGILNRDAAYFIGLWDSGHRQWQWVSQ---TPYNASATFWHKGEPSSDDEKCVIINHLNSGWGWN 221

  Fly   149 DVNCQEKKYFICEQNQMK 166
            |:.|..|:..:|:..:::
  Rat   222 DIPCSGKQQSVCQMKKIQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 23/124 (19%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 25/135 (19%)
Mannose binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 200..202 0/1 (0%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 211..213 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.