DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4b2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:134 Identity:24/134 - (17%)
Similarity:56/134 - (41%) Gaps:14/134 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG 96
            |.|.: :.....|::......||..::..|...|.:|..:.:.|:...:...:.::.|:    |.
  Rat    79 CPKDW-KSFGSHCYFTTDFVANWNESKEKCSHMGAHLLVIHSQEEQDFINGILDTRWGY----FT 138

  Fly    97 GNDLQSEGRFKYISS---GKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVL-DVNCQEKKY 157
            |...|.:.::::|..   .:.|.:..:.   ||  .::.:.|:||....::.... |:.|..:..
  Rat   139 GLSDQGQNQWQWIDQTPYNESVTFWHED---EP--NNDYEKCVEINHHKDIGWGWNDIVCSSEHK 198

  Fly   158 FICE 161
            .||:
  Rat   199 SICQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 22/123 (18%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 23/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.