DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and ASGR2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_011522164.2 Gene:ASGR2 / 433 HGNCID:743 Length:410 Species:Homo sapiens


Alignment Length:133 Identity:27/133 - (20%)
Similarity:56/133 - (42%) Gaps:18/133 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
            |..|.|::.......|..|:..|..:..:|..:::.|:.|.:|.:...   |:. |.|..|  |:
Human   282 EHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNP---FNT-WIGLTD--SD 340

  Fly   104 GRFKYISSGKLVRYMGDSNIVEPT-----QRSNLDDCLEIRI--RPNVTVVLDVNCQEKKYFICE 161
            |.:|::..........:..:.:|.     :....:||:|::.  |.|     |..|.:...::||
Human   341 GSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWN-----DDFCLQVYRWVCE 400

  Fly   162 QNQ 164
            :.:
Human   401 KRR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/125 (19%)
ASGR2XP_011522164.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.