DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and ASGR1

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:66 Identity:17/66 - (25%)
Similarity:31/66 - (46%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKY 108
            |::.......|..|.|.|..:..:|..|::.|:.|.|.|:    :|..:.|.|.:|  ..|.:|:
Human   165 CYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHH----IGPVNTWMGLHD--QNGPWKW 223

  Fly   109 I 109
            :
Human   224 V 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 17/66 (26%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Lectin_N 4..144 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 154..279 CDD:153060 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.