DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CLEC17A

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:141 Identity:33/141 - (23%)
Similarity:63/141 - (44%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTM--EDFKAVVHYVTSQVGFDDFW 94
            |.:.:| ...|||:|......:|..|:..|.....:|..:::.  .:|.|..| .:.:|    :|
Human   254 CPEGWL-PFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAH-GSPRV----YW 312

  Fly    95 FGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNL--DDCLEIRIRPNVTVVLDVNCQEKKY 157
            .|.||...||.::::....:.     .:..||.:.:|:  :||..:.......   |::|.:..|
Human   313 LGLNDRAQEGDWRWLDGSPVT-----LSFWEPEEPNNIHDEDCATMNKGGTWN---DLSCYKTTY 369

  Fly   158 FICEQNQMKCA 168
            :|||:   ||:
Human   370 WICER---KCS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 27/122 (22%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
PHA03247 <6..153 CDD:223021
CLECT_DC-SIGN_like 254..374 CDD:153060 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.