DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4b2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001004159.1 Gene:Clec4b2 / 381809 MGIID:3588267 Length:208 Species:Mus musculus


Alignment Length:165 Identity:28/165 - (16%)
Similarity:69/165 - (41%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMTVHSG--C-GKKQSKKEKDKGPCGKPYLRELNGKCFYVGI-KKINWFGAQNNCLRKGLNLADV 71
            |.|.||.  | .:..:..||....|.|.: :.....|::... .:.:...::..|..:|.:|..:
Mouse    55 LHTYHSNLICFSEGTTVSEKVWSCCPKDW-KPFGSYCYFTSTDSRASQNKSEEKCSLRGAHLVVI 118

  Fly    72 STMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYI-----SSGKLVRYMGDSNIVEPTQRSN 131
            .:.|:...:...:.:..|   ::.|.:|: ...::::|     :......:.|:.|       ::
Mouse   119 HSQEEQDFITRMLDTAAG---YFIGLSDV-GNSQWRWIDQTPYNDRATFWHKGEPN-------ND 172

  Fly   132 LDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQMK 166
            .:.|:.:..|..:....|::|.:::..:|   |||
Mouse   173 YEKCVILNYRKTMWGWNDIDCSDEENSVC---QMK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 16/124 (13%)
Clec4b2NP_001004159.1 CLECT_DC-SIGN_like 79..203 CDD:153060 18/138 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.