DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and tfc

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:132 Identity:40/132 - (30%)
Similarity:68/132 - (51%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRELNGKCFYVGI-KKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTS-QVGFDDFWFGGND 99
            |.:|..|.:|:|| .|.|||.|...|...|::||.:|:.|:...:..::.. .:|.:.||..|.|
  Fly   242 LLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTD 306

  Fly   100 LQSEGRFKYISSGKLVRYMGDSNIVEPT----QRSNLDDCLEIRIRPNVTVVL-DVNCQEKKYFI 159
            |..||.|.::::|:.:.:. :.|..||.    :....::|||:..|....:.. |..|..:.||:
  Fly   307 LADEGNFFWMATGRPITFT-NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFV 370

  Fly   160 CE 161
            ||
  Fly   371 CE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 38/126 (30%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.