DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and tfc

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:132 Identity:40/132 - (30%)
Similarity:68/132 - (51%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRELNGKCFYVGI-KKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTS-QVGFDDFWFGGND 99
            |.:|..|.:|:|| .|.|||.|...|...|::||.:|:.|:...:..::.. .:|.:.||..|.|
  Fly   242 LLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTD 306

  Fly   100 LQSEGRFKYISSGKLVRYMGDSNIVEPT----QRSNLDDCLEIRIRPNVTVVL-DVNCQEKKYFI 159
            |..||.|.::::|:.:.:. :.|..||.    :....::|||:..|....:.. |..|..:.||:
  Fly   307 LADEGNFFWMATGRPITFT-NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFV 370

  Fly   160 CE 161
            ||
  Fly   371 CE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 38/126 (30%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/125 (30%)

Return to query results.
Submit another query.