powered by:
Protein Alignment lectin-46Ca and CG13587
DIOPT Version :9
Sequence 1: | NP_652633.1 |
Gene: | lectin-46Ca / 53523 |
FlyBaseID: | FBgn0040093 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611939.1 |
Gene: | CG13587 / 37930 |
FlyBaseID: | FBgn0035031 |
Length: | 324 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 15/38 - (39%) |
Similarity: | 18/38 - (47%) |
Gaps: | 6/38 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 RILPIVILTLMTVHSGCGKKQSKKEKDKGP-----CGK 34
|.||. |..:.|..|..|.:||..|.|.|| ||:
Fly 285 RELPF-ICEIHTARSTFGWEQSSSELDIGPNAVFECGR 321
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-46Ca | NP_652633.1 |
CLECT |
43..162 |
CDD:153057 |
|
CG13587 | NP_611939.1 |
CLECT |
160..293 |
CDD:153057 |
4/8 (50%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BNTX |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.