DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CG14500

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_611309.1 Gene:CG14500 / 37087 FlyBaseID:FBgn0034318 Length:190 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:54/131 - (41%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFD-DFWFGGNDLQSEGRF 106
            ||..|.....|::.:..:|......|..:|...:|..:..::.....:. :||..||.|.....:
  Fly    41 KCLLVDGSWKNFYESDRHCRSLNAGLLSISNPTEFNVINEWLPIIAPYQPEFWTSGNKLGGTSDY 105

  Fly   107 KYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTV-----VLDVN------CQEKKYFIC 160
            .:.|:|:...|:..| ..:||  :...|||  .:..|||:     :|.|:      |.:....||
  Fly   106 YWQSTGQKAVYLPWS-AGQPT--TTAGDCL--TLMANVTMTPEEAILSVHRLTVKPCTQWAPHIC 165

  Fly   161 E 161
            :
  Fly   166 Q 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/131 (23%)
CG14500NP_611309.1 CLECT 31..166 CDD:214480 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.