DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:156 Identity:36/156 - (23%)
Similarity:64/156 - (41%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QSKKEKDKGPCGKPYLRE---LNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHY 83
            |.|.|...|.| :|..|:   .||.|::....:.||..:...|...|..|..|.|.|: :..:..
  Rat    93 QLKTEVHDGLC-QPCPRDWTFFNGSCYFFSKSQRNWHNSITACKELGAQLVIVETDEE-QTFLQQ 155

  Fly    84 VTSQVGFDDFWFGGNDLQSEGRFKYISSGKL----VRYMGDSNIVEPTQRSNLDDCLEIRIRPNV 144
            .:...|  ..|.|.:|:.:|..:.::....|    .:|.   |..||....: :||.|.    :.
  Rat   156 TSKTRG--PTWMGLSDMHNEATWHWVDGSPLSPSFAQYW---NRGEPNNVGD-EDCAEF----SG 210

  Fly   145 TVVLDVNCQEKKYFICEQ-NQMKCAV 169
            ....|:.|..:.::||:: :...|.:
  Rat   211 DGWNDLRCDTRIFWICKKVSTSSCTI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/122 (21%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.