DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Klrb1a

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001010964.1 Gene:Klrb1a / 362443 RGDID:1586149 Length:223 Species:Rattus norvegicus


Alignment Length:157 Identity:39/157 - (24%)
Similarity:66/157 - (42%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QSKKEKDKGP----CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVH 82
            |....|...|    |.|.:|.. ..|||:|....|.|..:..:|..||..|..|...|:.: .:.
  Rat    80 QENLSKTGSPAKLKCPKDWLSH-RDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELR-FLR 142

  Fly    83 YVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVV 147
            .:|.::. ..||.|.:...|:..:|:|:...|     :|:::..|..:..|.|..:    :...|
  Rat   143 NLTKRIS-SSFWIGLSYTLSDENWKWINGSTL-----NSDVLSITGDTEKDSCASV----SQDKV 197

  Fly   148 LDVNCQEKKYFICEQNQMKCAVPAEDS 174
            |..:|.....::| |.::||.....||
  Rat   198 LSESCDSDNIWVC-QKELKCECMCNDS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/118 (24%)
Klrb1aNP_001010964.1 LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.