DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4a3

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:149 Identity:25/149 - (16%)
Similarity:57/149 - (38%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKI-NWFGAQNNCLRKGLNLADVSTMEDFKAVV 81
            |.|..|..|.....|.....:..:..|::.....: :|..::..|...|.:|..:.:.|:...:.
  Rat    92 CTKWDSLLEDKVWSCCPKDWKPFDSNCYFPSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDFLP 156

  Fly    82 HYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNI---VEPTQRSNLDDCLEIRIRPN 143
            ..:.:...:    |.|.......:::::..   ..|.|::..   .||:  |:.:.|:.|....|
  Rat   157 RILDTHAAY----FIGLSDPGHRQWQWVDQ---TPYNGNATFWHEGEPS--SDNEQCVIINHHEN 212

  Fly   144 V-TVVLDVNCQEKKYFICE 161
            . ....|.:|.:|:..:|:
  Rat   213 TGWGWSDSSCSDKQKLVCQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 20/124 (16%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 19/132 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.