powered by:
Protein Alignment lectin-46Ca and clec-32
DIOPT Version :9
Sequence 1: | NP_652633.1 |
Gene: | lectin-46Ca / 53523 |
FlyBaseID: | FBgn0040093 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023952.1 |
Gene: | clec-32 / 3565962 |
WormBaseID: | WBGene00009860 |
Length: | 365 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 29/68 - (42%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 LNGKCFYVGIKKINWFGAQNNCLR-KGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG----GND 99
:||||:.:.........|.:.|:. .|..|..:...::..|:..:| |....|.||.| ||.
Worm 111 INGKCWRLFTDPQTRENADSVCMSYGGSTLFSIRNEQENNAIFDFV-SNSSVDYFWTGLICKGNT 174
Fly 100 LQS 102
:.|
Worm 175 ISS 177
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-46Ca | NP_652633.1 |
CLECT |
43..162 |
CDD:153057 |
16/65 (25%) |
clec-32 | NP_001023952.1 |
CLECT |
104..232 |
CDD:214480 |
18/68 (26%) |
CLECT |
249..356 |
CDD:214480 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.