DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CG11211

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:176 Identity:45/176 - (25%)
Similarity:65/176 - (36%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPIVIL-------TLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNC 61
            ||.:::       |.:|.:..|..                |.:.|......|..::||..|.:.|
  Fly    11 LPFLVIASSNINNTDLTFYQKCNP----------------LLQCNAYFSVAGFAEVNWLEANHVC 59

  Fly    62 LRKGLNLADVSTMEDFKAVVHYVTSQ---VGFDDFWFGGNDLQSEGRF-KYISSGKLVRYMGDSN 122
            .|.|..||.|...|..:.::|||..:   .|...||.|..:|.....| .::|:|..|.|...|.
  Fly    60 NRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSR 124

  Fly   123 IVEPTQRSNLDDCLEIRIRPNVTVVLDVN-------CQEKKYFICE 161
            ....:.|:..|.||          ||..:       ||.|..||||
  Fly   125 REPKSDRTGQDACL----------VLGTDNLWHSEPCQRKHNFICE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 38/130 (29%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.