DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:190 Identity:37/190 - (19%)
Similarity:80/190 - (42%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPIVILTLMTV-HSGCGKKQSKKEKDKGPC------GKPYLRELNGKCFYVGIKKINWFGAQNNC 61
            |.::::||:.: .:|..:::...:.::|..      .:|:.: :|...::.|.:.:||:.|...|
  Fly     4 LTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTK-INDGYYFFGTESLNWYEAYEKC 67

  Fly    62 LRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLV---RYMGDSNI 123
            ......|....|.::|.||..::|:......:|..||||...|..::.::.:.:   |:..:   
  Fly    68 RELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARN--- 129

  Fly   124 VEPTQRSNLDDCL------------EIRIRPNVTVVLDVNCQEK-----KYFICEQNQMK 166
             :|......:.|:            |:..||         |.:.     || |||..:|:
  Fly   130 -QPDNAGQKEHCIHLGYIYKDSRKFELNDRP---------CSQDPNSLFKY-ICEAPEME 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/138 (20%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.