DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CLEC4D

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_525126.2 Gene:CLEC4D / 338339 HGNCID:14554 Length:215 Species:Homo sapiens


Alignment Length:149 Identity:28/149 - (18%)
Similarity:62/149 - (41%) Gaps:11/149 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGKKQSKKEKDKGP---CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKA 79
            |.|::|:.:..:|.   |.....|.....|::.......|..::.||...|.:|..:||..:...
Human    66 CIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNF 130

  Fly    80 VVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKL--VRYMGDSNIVEPTQRSNLDDCLEIRIRP 142
            ::.::..::   .::.|..|..::|:::::.....  .|.....|  || ..|..::|:.:....
Human   131 IIQFLDRRL---SYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKN--EP-DNSQGENCVVLVYNQ 189

  Fly   143 NVTVVLDVNCQEKKYFICE 161
            :.....||.|..:...||:
Human   190 DKWAWNDVPCNFEASRICK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 22/121 (18%)
CLEC4DNP_525126.2 CLECT_DC-SIGN_like 84..208 CDD:153060 22/129 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2079
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.