DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-37Db

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:60/139 - (43%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKG---LNLADVSTMEDFKAVVHYVTSQVG 89
            :..|.|..|..|:..|.:|:.:.|.|||.|.|:|.:.|   |||.....:|.....:|...|   
  Fly    19 ESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYS--- 80

  Fly    90 FDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQE 154
               :|...|||...|.:...::|....::..| ..||...|..|.|:|:.:......:.|:.|..
  Fly    81 ---YWLSINDLGERGVYVSEATGLEAPFLNWS-AGEPDNSSGYDRCVELWLSTTSFQMNDLPCYS 141

  Fly   155 KKYFICEQN 163
            ...|||:.|
  Fly   142 SVAFICQLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 34/121 (28%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.