DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-37Db

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:60/139 - (43%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKG---LNLADVSTMEDFKAVVHYVTSQVG 89
            :..|.|..|..|:..|.:|:.:.|.|||.|.|:|.:.|   |||.....:|.....:|...|   
  Fly    19 ESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYS--- 80

  Fly    90 FDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQE 154
               :|...|||...|.:...::|....::..| ..||...|..|.|:|:.:......:.|:.|..
  Fly    81 ---YWLSINDLGERGVYVSEATGLEAPFLNWS-AGEPDNSSGYDRCVELWLSTTSFQMNDLPCYS 141

  Fly   155 KKYFICEQN 163
            ...|||:.|
  Fly   142 SVAFICQLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 34/121 (28%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 33/120 (28%)

Return to query results.
Submit another query.