DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209l1

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:Cd209l1 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:129 Identity:28/129 - (21%)
Similarity:60/129 - (46%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
            |.|::....:..|..:...|...|..|..:.:.|: ::.:...:...|  :.|.|.:|.|.|.::
  Rat    89 GNCYFFSTFQKKWKESVIACKDMGAQLVVIKSYEE-QSFLQRTSKMKG--NTWIGLSDSQEEDQW 150

  Fly   107 KYISSGKLVRYMGDSNIVEPTQRSNL--DDCLEIRIRP-NVTVVLDVNCQEKKYFICEQNQMKC 167
            .:: .|..:::....:..||   :||  :||:|..... |     |::|..:|::||:::...|
  Rat   151 LWV-DGSPLQWRNYWSAGEP---NNLYDEDCVEFSSYGWN-----DISCSFEKFWICKKSASPC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/121 (21%)
Cd209l1XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 27/122 (22%)

Return to query results.
Submit another query.