DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Colec10

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:192 Identity:49/192 - (25%)
Similarity:76/192 - (39%) Gaps:64/192 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GKKQSKKEK-------DKG------PCGKPY---------------------------LRELNGK 43
            |||..|.||       :||      .||: |                           :||...|
  Rat    95 GKKGDKGEKGLLGVPGEKGKAGTICDCGR-YRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEK 158

  Fly    44 CFYVGIKKINWFGAQNNCLRKGLNLA-----DVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
            .:|:..::.|:..:..:|..:|..||     .|:|:     :..|| ::.||...:.|.|||:.|
  Rat   159 FYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTL-----IADYV-AKSGFFRVFIGVNDLEKE 217

  Fly   104 GRFKYISSGKLVRYMGDSNIV--EPTQRSNLDDCLEIRI--RPNVTVVLDVNCQEKKYFICE 161
            |::.:..:..|..|   ||..  ||:.....:||:|:..  |.|     |..|....||:||
  Rat   218 GQYVFTDNTPLQNY---SNWKEGEPSDPYGHEDCVEMLSSGRWN-----DTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 36/128 (28%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478 8/20 (40%)
CLECT_collectin_like 157..272 CDD:153061 36/129 (28%)

Return to query results.
Submit another query.