DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4a2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005880.1 Gene:Clec4a2 / 297584 RGDID:1359163 Length:235 Species:Rattus norvegicus


Alignment Length:167 Identity:34/167 - (20%)
Similarity:65/167 - (38%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTLMTVHS-GCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGI-KKINWFGAQNNCLRKGLNLADV 71
            ||..|::. .|.|..|..|.....|.....:.....|::... .|..|..::..|.|.|.:|..:
  Rat    82 LTDKTLNDLNCTKNVSLTEDKACSCCLKDWKSFGSYCYFTSTDSKATWDESKEKCSRMGAHLLVI 146

  Fly    72 STM--EDF-KAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYI-----SSGKLVRYMGDSNIVEPTQ 128
            .:.  :|| ..:::..|      |::.|.:| .||.::::|     :......:.|:.|..|   
  Rat   147 HSQDEQDFINTILNIGT------DYFIGLSD-HSENQWQWIDQTPYNESVTFWHKGEPNNKE--- 201

  Fly   129 RSNLDDCLEIRIRP----NVTVVLDVNCQEKKYFICE 161
                :.|:.|..|.    |     |:.|.::...:|:
  Rat   202 ----EKCVVINHRDKWGWN-----DIPCHDRHKSVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/132 (20%)
Clec4a2NP_001005880.1 CLECT_DC-SIGN_like 107..229 CDD:153060 25/140 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.