DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd207

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:132 Identity:27/132 - (20%)
Similarity:50/132 - (37%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED----FKA---VVHYV-TSQVGF--DDFWF 95
            :|..:|.......|:.|:..|:.:..:|..||:..:    :||   :.|:: .::.|.  |.:|.
Mouse   206 SGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWV 270

  Fly    96 GGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFIC 160
            .......|...::...|            ||....|.:.|..||:.. :....|..|.....|||
Mouse   271 DQTSFNKEQSRRFWIPG------------EPNNAGNNEHCANIRVSA-LKCWNDGPCDNTFLFIC 322

  Fly   161 EQ 162
            ::
Mouse   323 KR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/128 (20%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.