DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd207

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:132 Identity:27/132 - (20%)
Similarity:50/132 - (37%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED----FKA---VVHYV-TSQVGF--DDFWF 95
            :|..:|.......|:.|:..|:.:..:|..||:..:    :||   :.|:: .::.|.  |.:|.
Mouse   206 SGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWV 270

  Fly    96 GGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFIC 160
            .......|...::...|            ||....|.:.|..||:.. :....|..|.....|||
Mouse   271 DQTSFNKEQSRRFWIPG------------EPNNAGNNEHCANIRVSA-LKCWNDGPCDNTFLFIC 322

  Fly   161 EQ 162
            ::
Mouse   323 KR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/128 (20%)
Cd207NP_659192.2 COG4372 65..>196 CDD:443500
CLECT_DC-SIGN_like 201..324 CDD:153060 27/130 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.