DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Asgr1

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:30/71 - (42%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
            |..|.|::.......|..|...|..:..:|..|::.|:.:    :|...:|..:.|.|..|  ..
  Rat   159 EYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQR----FVQQHMGPLNTWIGLTD--QN 217

  Fly   104 GRFKYI 109
            |.:|::
  Rat   218 GPWKWV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 14/67 (21%)
Asgr1NP_036635.1 Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859
CLECT_DC-SIGN_like 153..278 CDD:153060 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.