powered by:
Protein Alignment lectin-46Ca and Asgr1
DIOPT Version :9
Sequence 1: | NP_652633.1 |
Gene: | lectin-46Ca / 53523 |
FlyBaseID: | FBgn0040093 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_036635.1 |
Gene: | Asgr1 / 24210 |
RGDID: | 2160 |
Length: | 284 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 30/71 - (42%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 ELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
|..|.|::.......|..|...|..:..:|..|::.|:.: :|...:|..:.|.|..| ..
Rat 159 EYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQR----FVQQHMGPLNTWIGLTD--QN 217
Fly 104 GRFKYI 109
|.:|::
Rat 218 GPWKWV 223
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166344310 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.