DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-89

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:254 Identity:49/254 - (19%)
Similarity:89/254 - (35%) Gaps:91/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGK-CFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWF 95
            |.|.:..:..|: |:::..:::....|.:.|.:.   :||.|        .|.:..:.|      
 Worm    31 CPKSWHHDEPGRTCYHLARRRMRLTEAHSYCQKM---IADGS--------AHVLRVECG------ 78

  Fly    96 GGND--------------LQSEGRFKYIS---------------SGKLVRY--MGDSNIVEPTQR 129
            |.||              :.:..||..:.               :||:|||  ..:.|.:|....
 Worm    79 GENDFISGLVKGHSEKVWIDARARFDIVDGAAGLFGPGFVYRWPNGKIVRYSNWANGNGLEEVGS 143

  Fly   130 SNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHH---- 190
            ||.:.|:.|:...:   .::.||......|||:   |...|.      .||..:|..:...    
 Worm   144 SNSNKCINIKSDGH---WMNANCSSTAAVICEK---KLHRPY------SKHCPKHWVYNKETQAC 196

  Fly   191 -------------------DAGQKDKQETGIKEQSVESDSRPADNSNSTEIGVSKEKEA 230
                               |.|.:.:|:..:  .|:||:|     .|...:.::|||:|
 Worm   197 YRTISKTNMTILEADNKCFDYGFEHRQDAML--TSIESES-----ENQFVMNLAKEKDA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/150 (19%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480 30/160 (19%)
CLECT 183..321 CDD:214480 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.