DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Mgl2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:214 Identity:42/214 - (19%)
Similarity:68/214 - (31%) Gaps:68/214 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED---FKA 79
            |.....|....:..|...:..|..|.|::....:.:|..|...|..:..:|..|:::|:   .:.
Mouse   175 CQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQN 239

  Fly    80 VVHYVTSQVGFDD-----FWFGGNDLQSEGRFKYISSGKLV-RYMG-----------------DS 121
            .:..|.|.:|..|     .|..|.|.  :..|||:...:|. .|:|                 ..
Mouse   240 RLANVLSWMGLTDQNGPWRWVDGTDF--DKGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSG 302

  Fly   122 NIVE---------------PTQRSNL--------DDCLEIRI--RPNVTVVLDVNCQEKKYFICE 161
            |:.:               |.|..|.        :||.....  |.|     |..||...::|||
Mouse   303 NMADGQIWSAQFFIFRNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWN-----DDVCQRHYHWICE 362

  Fly   162 QN----------QMKCAVP 170
            ..          |:..:||
Mouse   363 TELGKASSAHSPQLIASVP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/169 (20%)
Mgl2XP_006532975.1 Lectin_N 39..180 CDD:367741 1/4 (25%)
CLECT_DC-SIGN_like 190..363 CDD:153060 35/179 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.