Sequence 1: | NP_652633.1 | Gene: | lectin-46Ca / 53523 | FlyBaseID: | FBgn0040093 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006532975.1 | Gene: | Mgl2 / 216864 | MGIID: | 2385729 | Length: | 381 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 42/214 - (19%) |
---|---|---|---|
Similarity: | 68/214 - (31%) | Gaps: | 68/214 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 CGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED---FKA 79
Fly 80 VVHYVTSQVGFDD-----FWFGGNDLQSEGRFKYISSGKLV-RYMG-----------------DS 121
Fly 122 NIVE---------------PTQRSNL--------DDCLEIRI--RPNVTVVLDVNCQEKKYFICE 161
Fly 162 QN----------QMKCAVP 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-46Ca | NP_652633.1 | CLECT | 43..162 | CDD:153057 | 33/169 (20%) |
Mgl2 | XP_006532975.1 | Lectin_N | 39..180 | CDD:367741 | 1/4 (25%) |
CLECT_DC-SIGN_like | 190..363 | CDD:153060 | 35/179 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167840910 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |