DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Sftpd

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:154 Identity:47/154 - (30%)
Similarity:56/154 - (36%) Gaps:42/154 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PADNSNSTEIGVSKEKEAEGAPTP-GDGG--GTTEPV---FENGMENAAEPIAEQEQTVPPGGTG 271
            |..:......|...||...|.|.| |..|  |.|.||   .|||......|..|:..:.|||..|
Mouse    47 PGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPG 111

  Fly   272 PPAAADATGAA----------TPAPDAAAA----------EGATPA----------AAPPAEGAP 306
            .|..|...|.:          .|.|...|.          :|:|.|          .||..:|||
Mouse   112 IPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAP 176

  Fly   307 A-AEAATPA-PAAPEGEATPAPAA 328
            . |.||.|| ||.|:|    ||.:
Mouse   177 GNAGAAGPAGPAGPQG----APGS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222 47/154 (31%)
gly_rich_SclB <60..>219 CDD:468478 45/141 (32%)
Surfac_D-trimer 223..267 CDD:286141
CLECT_collectin_like 261..374 CDD:153061
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.