DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-121

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001317732.1 Gene:clec-121 / 189537 WormBaseID:WBGene00021291 Length:500 Species:Caenorhabditis elegans


Alignment Length:123 Identity:33/123 - (26%)
Similarity:47/123 - (38%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KDKQETGIKEQSVESDSRPADNS-NSTEIGVSKEKEAEGAPTPGD-GGGTTEPVFENGMENAAEP 257
            :|...|.....:|.|.|.....: .||..|.:....|.|..|... .||:|......|..:....
 Worm    22 QDPTTTATSTTTVPSTSTVTTTTVASTSSGSTTASTAAGGSTSTTAAGGSTASTAAGGSTSTTAA 86

  Fly   258 IAEQEQTVPPGGTGPPAAADATGAATPAPDAAAAEGATPAAAPPAEGAPAAEAATPAP 315
            ......|...|.||..||..:| |:|.|..:.|:..|..:.|....||.:...::|||
 Worm    87 GGSTASTAAGGPTGSTAAGGST-ASTAAGGSTASTAAGGSTASTVAGATSVVPSSPAP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057
clec-121NP_001317732.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.