DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-127

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_494580.2 Gene:clec-127 / 189338 WormBaseID:WBGene00021138 Length:318 Species:Caenorhabditis elegans


Alignment Length:89 Identity:18/89 - (20%)
Similarity:29/89 - (32%) Gaps:28/89 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 HDAGQKDKQE---------TGIKEQS----VESD--SRPADNSNSTEIGVSKEKEAEGAP----- 234
            |.|.|.|.:|         ||::.:.    ::..  |.....|.|..:|:.:.....|.|     
 Worm   169 HHAAQADAEEACRSIGTTLTGLQNKQEALFIQKSLLSLIPQQSGSVWLGLQRTARCMGQPLTATC 233

  Fly   235 --------TPGDGGGTTEPVFENG 250
                    |.....||...:|:.|
 Worm   234 SRTTAFEWTDNSATGTDGFLFQTG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057
clec-127NP_494580.2 CLECT 147..274 CDD:214480 18/89 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.