DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-149

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:212 Identity:46/212 - (21%)
Similarity:75/212 - (35%) Gaps:63/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILPIVILTLMTVHSGCG-------------KK--------QSKKEKDKGPCGKPY---LRE---- 39
            |.|.|.:.:..:..||.             ||        |.:.||..|...|.:   |||    
 Worm   106 IRPPVPMPIPQISQGCNCNHDIEALEAKFDKKLYEVKMHAQYETEKGVGDLRKQFETDLREYERI 170

  Fly    40 --------------------LNGKCFYVGI-KKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHY 83
                                .|....|..| ::.:|:.|...|:..|.:||.:.:..:...|...
 Worm   171 TTKDIVEIKRHLDYLQAPRITNNDLEYFFIQREESWYTASEKCIGYGAHLASIHSRLELGFVQRL 235

  Fly    84 V-TSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRY--MGDSNIVEPTQRSNLDDCLEIRIRPNVT 145
            | .:|..    |.|.||:|.|..|:. |.|..|.:  .|..   :|..:.:.::|:|:......|
 Worm   236 VPVNQTA----WIGVNDIQKENVFRN-SDGTPVDFYKWGKK---QPDNQEHNENCVEVDHSGQWT 292

  Fly   146 VVLDVNCQEKKYFICEQ 162
               |..|...:.|:|::
 Worm   293 ---DKLCIITRPFVCKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/122 (25%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.