DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and F52E1.2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:137 Identity:27/137 - (19%)
Similarity:48/137 - (35%) Gaps:37/137 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTME 75
            |:....||            |.|..|   ||.||:......:.:.||.:.|..:|..|..:.:.:
 Worm    59 LIDCPGGC------------PTGWQY---LNSKCYKKFDAAVTYAGATSACAAQGAELVTIDSFD 108

  Fly    76 DFKAVVHYVTSQVGFD---------DFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSN 131
            :..|:      :..||         :.|.|...|....::...||.....:       .|:|.|:
 Worm   109 ENDAL------RKAFDTNALVDETKETWIGLKSLSGAWQWADGSSATYTNW-------APSQPSS 160

  Fly   132 LDDCLEI 138
            ...|:::
 Worm   161 NGLCVQM 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 19/105 (18%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.