Sequence 1: | NP_652633.1 | Gene: | lectin-46Ca / 53523 | FlyBaseID: | FBgn0040093 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023950.1 | Gene: | clec-28 / 186005 | WormBaseID: | WBGene00009857 | Length: | 402 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 36/203 - (17%) |
---|---|---|---|
Similarity: | 70/203 - (34%) | Gaps: | 46/203 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 LNGKCFYVGIKKINWFGAQNNCLR-KGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
Fly 104 GRFKY-----ISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDV------NCQEKKY 157
Fly 158 FICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQKDKQETGIKEQSVESDSR---PADNSNS 219
Fly 220 TEIGVSKE 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-46Ca | NP_652633.1 | CLECT | 43..162 | CDD:153057 | 25/130 (19%) |
clec-28 | NP_001023950.1 | CLECT | 146..274 | CDD:214480 | 24/132 (18%) |
CLECT | 288..396 | CDD:214480 | 7/49 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |