DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-45

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_504977.1 Gene:clec-45 / 184130 WormBaseID:WBGene00017199 Length:155 Species:Caenorhabditis elegans


Alignment Length:69 Identity:17/69 - (24%)
Similarity:30/69 - (43%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PCGKPYLREL-NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVT-SQVGFD-D 92
            ||...:.|.: .|:|..:.:..:::..|...|...|..:..:.......||:.:.| |..|.| |
 Worm    21 PCPTGFTRLVTTGQCLKMIVAPLSYSDASAKCKSLGAKVLTIQNAIQNNAVLSFATASATGNDKD 85

  Fly    93 FWFG 96
            :|.|
 Worm    86 YWLG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 13/56 (23%)
clec-45NP_504977.1 CLECT 22..153 CDD:214480 16/68 (24%)

Return to query results.
Submit another query.