DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-185

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_502375.4 Gene:clec-185 / 182914 WormBaseID:WBGene00007729 Length:504 Species:Caenorhabditis elegans


Alignment Length:301 Identity:56/301 - (18%)
Similarity:90/301 - (29%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNC--LRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEG 104
            |.|:....:|..|:|....|  |.....||...:..:.:    :|..:......|.|.:..::.|
 Worm    95 GCCYRTTDEKSEWYGGTELCRALHPQAQLASFHSQGESE----FVCKKYSSIHAWTGLSQTETPG 155

  Fly   105 RFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVL-----------DVNCQEKKYF 158
            .:.|........:....:....|::|    |:|  :...|.|:|           ..:|.|....
 Worm   156 VWTYTDGTPDWHWFFAQSSTMTTEKS----CVE--MMDGVLVLLFSWSAKKGQTQPYSCTESIAS 214

  Fly   159 ICEQNQMKCAVPAEDSGDGQKHSHEHLHHFHHDAGQKDKQETGIKEQSVESDSRP---ADNSNST 220
            ||:.    |  |.|.:......|          ........|.....:|.:.|.|   ..::.||
 Worm   215 ICKY----C--PQETTSTSTSTS----------TTTTTIPITSTVTTTVTTTSEPPTTVTSTTST 263

  Fly   221 EIGVSKEKEAEGAPTPGDGGGTTEPVFENGMENAAEPIAEQEQTV---PPGGTGPPAAADATGAA 282
            ....|.........|......||.|..:...|.... |...|.||   .|..|........|...
 Worm   264 TESTSTVTTTIPTTTTTTTVSTTVPTTKTTTETETS-IKPTETTVIITTPSTTTVTTTVPTTTVT 327

  Fly   283 TPAPDAAAAEGATPAAAPPAEGAPAAEAATPAPAAPEGEAT 323
            :.:.:.......|..:.|..  .|:..|:|.||...:...|
 Worm   328 STSSETTTTTRTTVTSTPAT--TPSIAASTKAPTTQKSTPT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/131 (18%)
clec-185NP_502375.4 CLECT 84..217 CDD:214480 24/131 (18%)
CLECT 391..500 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.