DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-83

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_500260.3 Gene:clec-83 / 177065 WormBaseID:WBGene00021879 Length:237 Species:Caenorhabditis elegans


Alignment Length:262 Identity:53/262 - (20%)
Similarity:89/262 - (33%) Gaps:52/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPIVILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNL 68
            ||:::.|  :|||.|....:               .:...|:.|..:::::..|...|.....:|
 Worm    10 LPLLLTT--SVHSQCASGDN---------------SIGDLCYVVVNQQLSYQDAVGYCHGISTSL 57

  Fly    69 ADVSTMEDFKAVVHYVTSQVGFDD--FWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSN 131
            |.|.|......:...:.::.|..|  ||.|.:...|..||.: ..|.::.:            ||
 Worm    58 AVVHTTLQANFLASTIRTKTGTSDSLFWIGLSRASSSSRFTW-DDGSVMYW------------SN 109

  Fly   132 LDDCLEIRIRPNVTVVLDVN-------CQEKKYFICEQNQMKCAVPAED----SGDGQKHSHEHL 185
            .|  |......|:.....:|       .|:|..|.|..|... ..||..    |.|....::...
 Worm   110 FD--LNFPKDNNIVAESVINGKWRTLAGQQKLVFACSYNPNN-VNPASTTPTYSTDASSSTYAPY 171

  Fly   186 HHFHHDAGQK--DKQETGIKEQSVESDSRPADNSNS---TEIGVSKEKEAEGAPTPGDGGGTTEP 245
            ..:..|:...  ....|.....|..:...|.|:|.|   |:...| ....:.:.:|...|.||..
 Worm   172 STYATDSSTAGYGSSATPYSTDSTTNTYGPTDSSASPYPTDSSTS-SYPTDSSTSPYSTGSTTSY 235

  Fly   246 VF 247
            :|
 Worm   236 IF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 27/127 (21%)
clec-83NP_500260.3 CLECT 22..143 CDD:214480 27/150 (18%)
PAP1 110..>236 CDD:369990 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.