DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-150

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_497312.1 Gene:clec-150 / 175261 WormBaseID:WBGene00019914 Length:362 Species:Caenorhabditis elegans


Alignment Length:206 Identity:43/206 - (20%)
Similarity:68/206 - (33%) Gaps:66/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCL-RKGLNLADV 71
            :|.|::|..|.......:|| ..|.||        .|:.|.....::..|:..|. ..|.:||.|
 Worm    11 LLFLISVSVGSAATCHGEEK-LDPSGK--------FCYVVHTGAASFHDAEKACYDYGGYHLASV 66

  Fly    72 STMEDFKAVVHYVT-SQVGFDDFWFGGNDLQSEGRFKYI----------SSGKLVRYMGDSNIVE 125
            .:|.|...:.:..: |.|..:.||.|..|:.::|.:::|          :|.....|.|.....:
 Worm    67 PSMIDNNFLYNLSSNSNVWANYFWIGLTDMTADGSWEWIDGLDLVFMNWASSSTAGYCGAMRAAD 131

  Fly   126 PTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKY-FIC------------------------EQNQM 165
              .|....||                  .|.| |.|                        ::|.:
 Worm   132 --ARWQAQDC------------------TKPYPFFCYGPALGAPTNPPNTPKTTQKPVRNQENMI 176

  Fly   166 KCAVPAEDSGD 176
            |....||..||
 Worm   177 KFMADAESVGD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/155 (18%)
clec-150NP_497312.1 CLECT 33..147 CDD:214480 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.