DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec-88

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_872010.1 Gene:clec-88 / 174056 WormBaseID:WBGene00019606 Length:243 Species:Caenorhabditis elegans


Alignment Length:162 Identity:30/162 - (18%)
Similarity:60/162 - (37%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHY----VTSQVGFDD 92
            |.:.::| .:..|::|..:.:.:..|:..|..|...|...:::::::|:..:    .:|.:|...
 Worm    81 CPEGWIR-YSDSCYWVETELLGFAKAERKCSEKQSTLFVANSIDEWEAIRGHSKDSFSSWIGLVR 144

  Fly    93 F-----------WFGGNDLQSEGRFK------YISSGKLVRYMGDSNIVEPTQR-----SNLDDC 135
            |           |      |:||...      |.:|....|....:.:::|...     |.|.:|
 Worm   145 FSHYERSEQLPRW------QTEGAVNPSKMCVYFASVLFQRKKFRNWLIKPYSPLVNGWSQLANC 203

  Fly   136 LEIRIRP----NVTVVLDVNCQEKKYFICEQN 163
            ......|    ..:......|....|.|||:|
 Worm   204 AASYKSPASLETASYTYFYPCTYLFYSICERN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/148 (18%)
clec-88NP_872010.1 CLECT 81..172 CDD:214480 16/97 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.