DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec10a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001191181.1 Gene:Clec10a / 17312 MGIID:96975 Length:305 Species:Mus musculus


Alignment Length:157 Identity:32/157 - (20%)
Similarity:55/157 - (35%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVH 82
            |.....|....:..|...:..|..|.|::....:.:|..|...|..:..:|..|:::|:...:.:
Mouse   159 CQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQN 223

  Fly    83 YVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIR 139
            .:.:.|.    |.|..|  ..|.::::......:  |..|.. |.|..|.        :||..|.
Mouse   224 RLANVVS----WIGLTD--QNGPWRWVDGTDFEK--GFKNWA-PLQPDNWFGHGLGGGEDCAHIT 279

  Fly   140 IRPNVTVVLDVNCQEKKYFICEQNQMK 166
            ......   |..||....:|||....|
Mouse   280 TGGPWN---DDVCQRTFRWICEMKLAK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/126 (20%)
Clec10aNP_001191181.1 Lectin_N 14..164 CDD:281887 1/4 (25%)
CLECT_DC-SIGN_like 174..299 CDD:153060 27/136 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.