DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Reg3a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001139318.1 Gene:Reg3a / 171162 RGDID:621401 Length:174 Species:Rattus norvegicus


Alignment Length:165 Identity:35/165 - (21%)
Similarity:59/165 - (35%) Gaps:17/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNC-LRKGLNLADVS 72
            |.:..|.....:|.....:...|.|....|..   |:.:.....:||.|...| .|...:|..:.
  Rat    18 LFIFQVRGEDSQKAVPSTRTSCPMGSKAYRSY---CYTLVTTLKSWFQADLACQKRPSGHLVSIL 79

  Fly    73 TMEDFKAVVHYVTSQVGFD-DFWFGGND----LQSEGRFKYISSGKLVRYM---GDSNIVEPTQR 129
            :..:...|...||.:|..: |.|.|.:|    .|..|.....|:..::.|:   ||     |:..
  Rat    80 SGGEASFVSSLVTGRVNNNQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGD-----PSST 139

  Fly   130 SNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQ 164
            .|..:|..:..........|.:|..:..|:|:..|
  Rat   140 VNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/127 (22%)
Reg3aNP_001139318.1 CLECT 39..172 CDD:295302 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.