DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Fcer2

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:134 Identity:33/134 - (24%)
Similarity:53/134 - (39%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG 96
            |.|.:| ....||:|.|.....|..|:..|......|..:.:.::...::.::..:    :.|.|
  Rat   186 CPKDWL-HFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHINKK----ESWIG 245

  Fly    97 GNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKY---F 158
            ..||..||.|.: ..|..|.|...|. .||......:||:.:|......   |..|  :.|   :
  Rat   246 LQDLNMEGEFVW-PDGSPVGYSNWSP-GEPNNGGQGEDCVMMRGSGQWN---DAFC--RSYLDAW 303

  Fly   159 ICEQ 162
            :|||
  Rat   304 VCEQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/121 (23%)
Fcer2NP_001029096.1 COG4372 60..>175 CDD:443500
CLECT_DC-SIGN_like 186..306 CDD:153060 30/131 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.