DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_573501.1 Gene:Cd209a / 170786 MGIID:2157942 Length:238 Species:Mus musculus


Alignment Length:133 Identity:30/133 - (22%)
Similarity:56/133 - (42%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
            |.|::..:.:.:|..:...|...|..|..:.:.|: :..:...:.:.|:.  |.|..|:..|..:
Mouse   117 GSCYFFSVAQKSWNDSATACHNVGAQLVVIKSDEE-QNFLQQTSKKRGYT--WMGLIDMSKESTW 178

  Fly   107 KYISSGKL----VRYMGDSNIVEPTQRSNL--DDCLEIRIRP-NVTVVLDVNCQEKKYFICEQNQ 164
            .::....|    ::|....   ||   :||  :||.|.|... |     |..|..||::||::..
Mouse   179 YWVDGSPLTLSFMKYWSKG---EP---NNLGEEDCAEFRDDGWN-----DTKCTNKKFWICKKLS 232

  Fly   165 MKC 167
            ..|
Mouse   233 TSC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/125 (22%)
Cd209aNP_573501.1 CLECT_DC-SIGN_like 108..230 CDD:153060 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.