powered by:
Protein Alignment lectin-46Ca and CLEC4F
DIOPT Version :9
Sequence 1: | NP_652633.1 |
Gene: | lectin-46Ca / 53523 |
FlyBaseID: | FBgn0040093 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011530937.1 |
Gene: | CLEC4F / 165530 |
HGNCID: | 25357 |
Length: | 699 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 20/67 - (29%) |
Similarity: | 37/67 - (55%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
|..:|....|.:|..|:..|:.:|.:||.|::.|:...:|.: ||:| .:|.|..|..:||.:
Human 588 GSLYYFSSVKKSWHEAEQFCVSQGAHLASVASKEEQAFLVEF-TSKV---YYWIGLTDRGTEGSW 648
Fly 107 KY 108
::
Human 649 RW 650
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165150861 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22802 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.