DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Fcer2a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:134 Identity:35/134 - (26%)
Similarity:55/134 - (41%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG 96
            |.|.:| ....||:|.|.....|..|:..|......|..:.:.::...::.::..:    |.|.|
Mouse   190 CPKNWL-HFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKK----DSWIG 249

  Fly    97 GNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKY---F 158
            ..||..||.|.: |.|..|.| .:.|..||......:||:.:|......   |..|  :.|   :
Mouse   250 LQDLNMEGEFVW-SDGSPVGY-SNWNPGEPNNGGQGEDCVMMRGSGQWN---DAFC--RSYLDAW 307

  Fly   159 ICEQ 162
            :|||
Mouse   308 VCEQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/121 (25%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056
CLECT_DC-SIGN_like 190..310 CDD:153060 32/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.